SCOP 1.55: Domain d1vkxa1: 1vkx A:192-291

Lineage for d1vkxa1 (1vkx A:192-291)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (23 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), C-terminal domain [49253] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (5 PDB entries)

8. Domain d1vkxa1: 1vkx A:192-291 [21941]
   Other proteins in same PDB: d1vkxa2, d1vkxb1, d1vkxb2

Details for d1vkxa1

PDB Entry: 1vkx, 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

SCOP Domain Sequences for d1vkxa1:

Sequence; same for both SEQRES and ATOM records:

>d1vkxa1 b.1.1.5 (A:192-291) p65 subunit of NF-kappa B (NFKB), C-terminal domain {Mouse (Mus musculus)}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

Timeline for d1vkxa1:

• d1vkxa1 appears in SCOP 1.57
  
• d1vkxa1 appears in the current release, SCOPe 2.08