Lineage for d4bagb1 (4bag B:803-1077)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151048Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 2151076Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 2151077Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 2151085Domain d4bagb1: 4bag B:803-1077 [219396]
    Other proteins in same PDB: d4baga2, d4bagb2
    automated match to d1gkka_
    complexed with cd, gol

Details for d4bagb1

PDB Entry: 4bag (more details), 1.9 Å

PDB Description: feruloyl esterase domain of xyny from clostridium thermocellum after exposure to 266nm uv laser
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d4bagb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bagb1 c.69.1.2 (B:803-1077) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhe

SCOPe Domain Coordinates for d4bagb1:

Click to download the PDB-style file with coordinates for d4bagb1.
(The format of our PDB-style files is described here.)

Timeline for d4bagb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bagb2