Lineage for d4bagb_ (4bag B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1382705Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1382733Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 1382734Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 1382742Domain d4bagb_: 4bag B: [219396]
    automated match to d1gkka_
    complexed with cd, gol

Details for d4bagb_

PDB Entry: 4bag (more details), 1.9 Å

PDB Description: feruloyl esterase domain of xyny from clostridium thermocellum after exposure to 266nm uv laser
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d4bagb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bagb_ c.69.1.2 (B:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

SCOPe Domain Coordinates for d4bagb_:

Click to download the PDB-style file with coordinates for d4bagb_.
(The format of our PDB-style files is described here.)

Timeline for d4bagb_: