SCOPe 2.03: Domain d4bagb_: 4bag B:

Lineage for d4bagb_ (4bag B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)

8. Domain d4bagb_: 4bag B: [219396]
   automated match to d1gkka_
   complexed with cd, gol

Details for d4bagb_

PDB Entry: 4bag, 1.9 Å

PDB Description: feruloyl esterase domain of xyny from clostridium thermocellum after exposure to 266nm uv laser

PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d4bagb_:

Sequence; same for both SEQRES and ATOM records:

>d4bagb_ c.69.1.2 (B:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

Timeline for d4bagb_:

• d4bagb_ is new in SCOPe 2.03-stable
  
• d4bagb_ appears in SCOPe 2.04
  
• d4bagb_ appears in the current release, SCOPe 2.08, called d4bagb1