![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
![]() | Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species) |
![]() | Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries) |
![]() | Domain d4baga_: 4bag A: [219395] automated match to d1gkka_ complexed with cd, gol |
PDB Entry: 4bag (more details), 1.9 Å
SCOPe Domain Sequences for d4baga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4baga_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
Timeline for d4baga_: