Lineage for d4baga_ (4bag A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869452Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1869480Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 1869481Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 1869488Domain d4baga_: 4bag A: [219395]
    automated match to d1gkka_
    complexed with cd, gol

Details for d4baga_

PDB Entry: 4bag (more details), 1.9 Å

PDB Description: feruloyl esterase domain of xyny from clostridium thermocellum after exposure to 266nm uv laser
PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d4baga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4baga_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfsmgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

SCOPe Domain Coordinates for d4baga_:

Click to download the PDB-style file with coordinates for d4baga_.
(The format of our PDB-style files is described here.)

Timeline for d4baga_: