Lineage for d4babc_ (4bab C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010509Species Taxus wallichiana [TaxId:29808] [189805] (9 PDB entries)
  8. 2010538Domain d4babc_: 4bab C: [219391]
    automated match to d2yiia_

Details for d4babc_

PDB Entry: 4bab (more details), 2.56 Å

PDB Description: Redesign of a Phenylalanine Aminomutase into a beta-Phenylalanine Ammonia Lyase
PDB Compounds: (C:) phenylalanine aminomutase

SCOPe Domain Sequences for d4babc_:

Sequence, based on SEQRES records: (download)

>d4babc_ a.127.1.0 (C:) automated matches {Taxus wallichiana [TaxId: 29808]}
shvkdilglinafnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcssw
vqrkaedgadiygvttgfgacssrrtnrlselqeslircllagvftkgcapsvdelpata
trsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayiagl
ligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatavastvmydan
vllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqelsrey
ysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandralhg
anfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdyglkg
ldiamaaysselqylanpvtthvhsaeqhnqdinslalisarkteealdilklmiashlt
amcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcdpt
lplllglkqscfdtilalhkkdgietdtlvdrlaefekrlsdrlenemtavrvlyekkgh
ktadnndalvriqgskflpfyrfvreeldtgvmsarreqtpqedvqkvfdaiadgritvp
llhclqgf

Sequence, based on observed residues (ATOM records): (download)

>d4babc_ a.127.1.0 (C:) automated matches {Taxus wallichiana [TaxId: 29808]}
shvkdilglinafnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcssw
vqrkaselqeslircllagvftdelpatatrsamllrlnsftygcsgirwevmealekll
nsnvspkvplrgsvsasgdliplayiaglligkpsviarigddvevpapealsrvglrpf
klqakeglalvngtsfatavastvmydanvllllvetlcgmfcevifgreefahplihkv
kphpgqiesaellewllrsspfqelsreyysidklkkpkqdryalrsspqwlaplvqtir
datttvetevnsandnpiidhandralhganfqgsavgfymdyvriavaglgkllfaqft
elmieyysnglpgnlslgpdlsvdyglkgldiamaaysselqylanpvtthvhsaeqhnq
dinslalisarkteealdilklmiashltamcqavdlrqleealvkvvenvvstladecg
lpndtkarllyvakavpvytylespcdptlplllglkqscfdtilalhkdtlvdrlaefe
krlsdrlenemtavrvlyevriqgskflpfyrfvreeldtgvmsarreqtpqedvqkvfd
aiadgritvpllhclqgf

SCOPe Domain Coordinates for d4babc_:

Click to download the PDB-style file with coordinates for d4babc_.
(The format of our PDB-style files is described here.)

Timeline for d4babc_: