Lineage for d4baba_ (4bab A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010509Species Taxus wallichiana [TaxId:29808] [189805] (9 PDB entries)
  8. 2010536Domain d4baba_: 4bab A: [219389]
    automated match to d2yiia_

Details for d4baba_

PDB Entry: 4bab (more details), 2.56 Å

PDB Description: Redesign of a Phenylalanine Aminomutase into a beta-Phenylalanine Ammonia Lyase
PDB Compounds: (A:) phenylalanine aminomutase

SCOPe Domain Sequences for d4baba_:

Sequence, based on SEQRES records: (download)

>d4baba_ a.127.1.0 (A:) automated matches {Taxus wallichiana [TaxId: 29808]}
shvkdilglinafnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcssw
vqrkaedgadiygvttgfgacssrrtnrlselqeslircllagvftkgcapsvdelpata
trsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayiagl
ligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatavastvmydan
vllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqelsrey
ysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandralhg
anfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdyglkg
ldiamaaysselqylanpvtthvhsaeqhnqdinslalisarkteealdilklmiashlt
amcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcdpt
lplllglkqscfdtilalhkkdgietdtlvdrlaefekrlsdrlenemtavrvlyekkgh
ktadnndalvriqgskflpfyrfvreeldtgvmsarreqtpqedvqkvfdaiadgritvp
llhclqgfl

Sequence, based on observed residues (ATOM records): (download)

>d4baba_ a.127.1.0 (A:) automated matches {Taxus wallichiana [TaxId: 29808]}
shvkdilglinafnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcssw
vqrkaeselqeslircllagvftdelpatatrsamllrlnsftygcsgirwevmealekl
lnsnvspkvplrgsvsasgdliplayiaglligkpsviarigddvevpapealsrvglrp
fklqakeglalvngtsfatavastvmydanvllllvetlcgmfcevifgreefahplihk
vkphpgqiesaellewllrsspfqelsreyysidklkkpkqdryalrsspqwlaplvqti
rdatttvetevnsandnpiidhandralhganfqgsavgfymdyvriavaglgkllfaqf
telmieyysnglpgnlslgpdlsvdyglkgldiamaaysselqylanpvtthvhsaeqhn
qdinslalisarkteealdilklmiashltamcqavdlrqleealvkvvenvvstladec
glpndtkarllyvakavpvytylespcdptlplllglkqscfdtilalhdtlvdrlaefr
lenemtavrvlyekvriqgskflpfyrfvreeldtgvmsarreqtpqedvqkvfdaiadg
ritvpllhclqgfl

SCOPe Domain Coordinates for d4baba_:

Click to download the PDB-style file with coordinates for d4baba_.
(The format of our PDB-style files is described here.)

Timeline for d4baba_: