Lineage for d4ba1i2 (4ba1 I:66-152)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314898Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1315318Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species)
  7. 1315325Species Sulfolobus solfataricus [TaxId:2287] [159102] (4 PDB entries)
    Uniprot Q9UXC4 66-152
  8. 1315327Domain d4ba1i2: 4ba1 I:66-152 [219380]
    Other proteins in same PDB: d4ba1a1, d4ba1a2, d4ba1b1, d4ba1b2, d4ba1i1, d4ba1i3
    automated match to d2je6i1
    complexed with 1pe, na, peg, po4

Details for d4ba1i2

PDB Entry: 4ba1 (more details), 1.8 Å

PDB Description: Archaeal exosome (Rrp4-Rrp41(D182A)-Rrp42) bound to inorganic phosphate
PDB Compounds: (I:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d4ba1i2:

Sequence, based on SEQRES records: (download)

>d4ba1i2 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy
viarienfdrsidpvlsvkgkdlgrvs

Sequence, based on observed residues (ATOM records): (download)

>d4ba1i2 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]}
sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgerryldvgdyvi
arienfdrsidpvlsvkgkdlgrvs

SCOPe Domain Coordinates for d4ba1i2:

Click to download the PDB-style file with coordinates for d4ba1i2.
(The format of our PDB-style files is described here.)

Timeline for d4ba1i2: