Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [159102] (4 PDB entries) Uniprot Q9UXC4 66-152 |
Domain d4ba1i2: 4ba1 I:66-152 [219380] Other proteins in same PDB: d4ba1a1, d4ba1a2, d4ba1b1, d4ba1b2, d4ba1i1, d4ba1i3 automated match to d2je6i1 complexed with 1pe, na, peg, po4 |
PDB Entry: 4ba1 (more details), 1.8 Å
SCOPe Domain Sequences for d4ba1i2:
Sequence, based on SEQRES records: (download)
>d4ba1i2 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgedlrryldvgdy viarienfdrsidpvlsvkgkdlgrvs
>d4ba1i2 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} sfyypkindiviglvedveiygwvvdikapykaylpasnllgrsinvgerryldvgdyvi arienfdrsidpvlsvkgkdlgrvs
Timeline for d4ba1i2:
View in 3D Domains from other chains: (mouse over for more information) d4ba1a1, d4ba1a2, d4ba1b1, d4ba1b2 |