Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries) |
Domain d2ramb1: 2ram B:192-291 [21938] Other proteins in same PDB: d2rama2, d2ramb2 protein/DNA complex; complexed with dtv |
PDB Entry: 2ram (more details), 2.4 Å
SCOPe Domain Sequences for d2ramb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ramb1 b.1.18.1 (B:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd
Timeline for d2ramb1: