Lineage for d4ba1b1 (4ba1 B:8-155)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157612Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 protein domains)
  6. 2157613Protein Exosome complex exonuclease 1, ECX1 [159923] (2 species)
  7. 2157621Species Sulfolobus solfataricus [TaxId:2287] [159924] (9 PDB entries)
    Uniprot Q9UXC2 8-155
  8. 2157623Domain d4ba1b1: 4ba1 B:8-155 [219377]
    Other proteins in same PDB: d4ba1a1, d4ba1a2, d4ba1a3, d4ba1b2, d4ba1i1, d4ba1i2, d4ba1i3
    automated match to d2je6b1
    complexed with 1pe, na, peg, po4

Details for d4ba1b1

PDB Entry: 4ba1 (more details), 1.8 Å

PDB Description: Archaeal exosome (Rrp4-Rrp41(D182A)-Rrp42) bound to inorganic phosphate
PDB Compounds: (B:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d4ba1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ba1b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
fteilqadagsrlvslmaaslaladagi

SCOPe Domain Coordinates for d4ba1b1:

Click to download the PDB-style file with coordinates for d4ba1b1.
(The format of our PDB-style files is described here.)

Timeline for d4ba1b1: