| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins) contains two additional beta-strands in the N-terminal extension |
| Protein automated matches [191220] (2 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:208964] [193354] (6 PDB entries) |
| Domain d4b8ue_: 4b8u E: [219373] automated match to d4b0jt_ complexed with ibk, so4 |
PDB Entry: 4b8u (more details), 2.76 Å
SCOPe Domain Sequences for d4b8ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b8ue_ d.38.1.2 (E:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
kqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldinp
dlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlptak
kvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstdsf
Timeline for d4b8ue_:
View in 3DDomains from other chains: (mouse over for more information) d4b8ua_, d4b8ub_, d4b8uc_, d4b8ud_ |