Lineage for d4b8ud_ (4b8u D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943682Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2943693Protein automated matches [191220] (4 species)
    not a true protein
  7. 2943694Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193354] (7 PDB entries)
  8. 2943715Domain d4b8ud_: 4b8u D: [219372]
    automated match to d4b0jt_
    complexed with ibk, so4

Details for d4b8ud_

PDB Entry: 4b8u (more details), 2.76 Å

PDB Description: Crystal Structure of 3-hydroxydecanoyl-Acyl Carrier Protein Dehydratase (FabA) from Pseudomonas aeruginosa in complex with N- isobutyl-2-(5-(2-thienyl)-1,2-oxazol-3-yl-)methoxy)acetamide
PDB Compounds: (D:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4b8ud_:

Sequence, based on SEQRES records: (download)

>d4b8ud_ d.38.1.2 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
kqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldinp
dlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlptak
kvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstd

Sequence, based on observed residues (ATOM records): (download)

>d4b8ud_ d.38.1.2 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
kqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldinp
dlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlptak
kvtynihikrtinlvlaiadgtvsvdgreiysaeglrvglftstd

SCOPe Domain Coordinates for d4b8ud_:

Click to download the PDB-style file with coordinates for d4b8ud_.
(The format of our PDB-style files is described here.)

Timeline for d4b8ud_: