Lineage for d4b8uc_ (4b8u C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1901881Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 1901892Protein automated matches [191220] (3 species)
    not a true protein
  7. 1901893Species Pseudomonas aeruginosa [TaxId:208964] [193354] (7 PDB entries)
  8. 1901913Domain d4b8uc_: 4b8u C: [219371]
    automated match to d4b0jt_
    complexed with ibk, so4

Details for d4b8uc_

PDB Entry: 4b8u (more details), 2.76 Å

PDB Description: Crystal Structure of 3-hydroxydecanoyl-Acyl Carrier Protein Dehydratase (FabA) from Pseudomonas aeruginosa in complex with N- isobutyl-2-(5-(2-thienyl)-1,2-oxazol-3-yl-)methoxy)acetamide
PDB Compounds: (C:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4b8uc_:

Sequence, based on SEQRES records: (download)

>d4b8uc_ d.38.1.2 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglft

Sequence, based on observed residues (ATOM records): (download)

>d4b8uc_ d.38.1.2 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinlvlaiadgtvsvdgreiysaeglrvglft

SCOPe Domain Coordinates for d4b8uc_:

Click to download the PDB-style file with coordinates for d4b8uc_.
(The format of our PDB-style files is described here.)

Timeline for d4b8uc_: