Lineage for d4b8sa_ (4b8s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904954Species Thermococcus litoralis [TaxId:2265] [226717] (2 PDB entries)
  8. 2904956Domain d4b8sa_: 4b8s A: [219368]
    automated match to d1ua4a_
    complexed with amp, glc, gol

Details for d4b8sa_

PDB Entry: 4b8s (more details), 2.58 Å

PDB Description: crystal structure of thermococcus litoralis adp-dependent glucokinase (gk)
PDB Compounds: (A:) ADP-dependent glucokinase

SCOPe Domain Sequences for d4b8sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b8sa_ c.72.1.0 (A:) automated matches {Thermococcus litoralis [TaxId: 2265]}
keslkdrirlwkrlyvnafenalnaipnvkgvllayntnidaikyldkddlekrvteigk
ekvfeiienppekissieellggilrsiklgkamewfveseevrrylrewgwdelriggq
agimanllggvyriptivhvpqnpklqaelfvdgpiyvpvfegnklklvhpkdaiaeeee
lihyiyefprgfqvfdvqaprenrfianaddynarvymrrefregfeeitrnvelaiisg
lqvlkeyypdgttyrdvldrveshlnilnrynvkshfefaytanrrvrealvellpkfts
vglnevelasimeiigdeelakevleghifsvidamnvlmdetgierihfhtygyylalt
qyrgeevrdallfaslaaaakamkgnlerieqirdalsvptneraivleeelekeftefe
nglidmvdrqlafvptkivaspkstvgigdtisssafvsefgmrkr

SCOPe Domain Coordinates for d4b8sa_:

Click to download the PDB-style file with coordinates for d4b8sa_.
(The format of our PDB-style files is described here.)

Timeline for d4b8sa_: