Lineage for d4b8mb_ (4b8m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983277Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries)
  8. 2983284Domain d4b8mb_: 4b8m B: [219366]
    automated match to d2bfyb_
    complexed with vx6

Details for d4b8mb_

PDB Entry: 4b8m (more details), 1.85 Å

PDB Description: Aurora B kinase in complex with VX-680
PDB Compounds: (B:) aurora kinase b-a

SCOPe Domain Sequences for d4b8mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b8mb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvyqs

SCOPe Domain Coordinates for d4b8mb_:

Click to download the PDB-style file with coordinates for d4b8mb_.
(The format of our PDB-style files is described here.)

Timeline for d4b8mb_: