Lineage for d4b8ma_ (4b8m A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931584Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (9 PDB entries)
  8. 1931590Domain d4b8ma_: 4b8m A: [219365]
    automated match to d2bfyb_
    complexed with vx6

Details for d4b8ma_

PDB Entry: 4b8m (more details), 1.85 Å

PDB Description: Aurora B kinase in complex with VX-680
PDB Compounds: (A:) aurora kinase b-a

SCOPe Domain Sequences for d4b8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b8ma_ d.144.1.7 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
hppqrlplkgvmehpwvkansrrvlppvyqs

SCOPe Domain Coordinates for d4b8ma_:

Click to download the PDB-style file with coordinates for d4b8ma_.
(The format of our PDB-style files is described here.)

Timeline for d4b8ma_: