SCOPe 2.06: Domain d1ikna1: 1ikn A:192-303

Lineage for d1ikna1 (1ikn A:192-303)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries)

8. Domain d1ikna1: 1ikn A:192-303 [21936]
   Other proteins in same PDB: d1ikna2, d1iknc_, d1iknd_

Details for d1ikna1

PDB Entry: 1ikn, 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex

PDB Compounds: (A:) protein (nf-kappa-b p65 subunit)

SCOPe Domain Sequences for d1ikna1:

Sequence; same for both SEQRES and ATOM records:

>d1ikna1 b.1.18.1 (A:192-303) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrk

Timeline for d1ikna1:

• d1ikna1 first appeared (with stable ids) in SCOP 1.55
  
• d1ikna1 appears in SCOPe 2.05
  
• d1ikna1 appears in SCOPe 2.07
  
• d1ikna1 appears in the current release, SCOPe 2.08