SCOPe 2.08: Domain d1bftb_: 1bft B:

Lineage for d1bftb_ (1bft B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries)

8. Domain d1bftb_: 1bft B: [21935]

Details for d1bftb_

PDB Entry: 1bft, 2 Å

PDB Description: structure of nf-kb p50 homodimer bound to a kb site

PDB Compounds: (B:) nuclear factor nf-kappa-b p65

SCOPe Domain Sequences for d1bftb_:

Sequence; same for both SEQRES and ATOM records:

>d1bftb_ b.1.18.1 (B:) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
taelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvai
vfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

Timeline for d1bftb_:

• d1bftb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bftb_ appears in SCOPe 2.07