Lineage for d4b6oa_ (4b6o A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440429Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2440430Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains)
    automatically mapped to Pfam PF01220
  6. 2440431Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 2440478Species Mycobacterium tuberculosis [TaxId:1773] [52307] (16 PDB entries)
  8. 2440485Domain d4b6oa_: 4b6o A: [219341]
    automated match to d1h0sa_
    complexed with 3dq, so4

Details for d4b6oa_

PDB Entry: 4b6o (more details), 2 Å

PDB Description: structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4b6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6oa_ c.23.13.1 (A:) Type II 3-dehydroquinate dehydratase {Mycobacterium tuberculosis [TaxId: 1773]}
elivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldw
ihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspia
tgvivglgiqgyllalrylaeh

SCOPe Domain Coordinates for d4b6oa_:

Click to download the PDB-style file with coordinates for d4b6oa_.
(The format of our PDB-style files is described here.)

Timeline for d4b6oa_: