![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
![]() | Family b.34.10.0: automated matches [227283] (1 protein) not a true family |
![]() | Protein automated matches [227098] (1 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226500] (1 PDB entry) |
![]() | Domain d4b6ma_: 4b6m A: [219339] automated match to d1txqa1 complexed with fmt |
PDB Entry: 4b6m (more details), 1.59 Å
SCOPe Domain Sequences for d4b6ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b6ma_ b.34.10.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} tihvgdrclcrpgdrlgsvrfvgrvaslkpgywvgvefdepvgkgdgtvkgtrvfqcqpn yggflrpdqvevgdfppevf
Timeline for d4b6ma_: