SCOPe 2.05: Domain d4b5ya_: 4b5y A:

Lineage for d4b5ya_ (4b5y A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (40 PDB entries)

8. Domain d4b5ya_: 4b5y A: [219338]
   automated match to d2ye1a_
   mutant

Details for d4b5ya_

PDB Entry: 4b5y, 1.45 Å

PDB Description: x-ray structure of the cyan fluorescent protein mturquoise-gl (k206a mutant) in space group c222(1)

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4b5ya_:

Sequence; same for both SEQRES and ATOM records:

>d4b5ya_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
lvttlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynyisgnvyitadkqkngikanfkirhniedggvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefltaagitl

Timeline for d4b5ya_:

• d4b5ya_ first appeared in SCOPe 2.03
  
• d4b5ya_ appears in SCOPe 2.04
  
• d4b5ya_ is called d4b5ya1 in SCOPe 2.06
  
• d4b5ya_ appears in the current release, SCOPe 2.08, called d4b5ya1