SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4b5ya1 (4b5y A:2-230)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (17 species)
    not a true protein
  7. 2165183Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (44 PDB entries)
  8. 2165195Domain d4b5ya1: 4b5y A:2-230 [219338]
    Other proteins in same PDB: d4b5ya2, d4b5ya3
    automated match to d2ye1a_
    mutant

Details for d4b5ya1

PDB Entry: 4b5y (more details), 1.45 Å

PDB Description: X-ray structure of the cyan fluorescent protein mTurquoise-GL (K206A mutant) in space group C222(1)
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4b5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b5ya1 d.22.1.1 (A:2-230) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynyisgnvyitadkqkngikanfkirhniedggvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefltaagit

SCOPe Domain Coordinates for d4b5ya1:

Click to download the PDB-style file with coordinates for d4b5ya1.
(The format of our PDB-style files is described here.)

Timeline for d4b5ya1: