Lineage for d4b5ya1 (4b5y A:2-230)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (17 species)
    not a true protein
  7. 2165183Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (48 PDB entries)
  8. 2165195Domain d4b5ya1: 4b5y A:2-230 [219338]
    Other proteins in same PDB: d4b5ya2, d4b5ya3
    automated match to d2ye1a_
    mutant

Details for d4b5ya1

PDB Entry: 4b5y (more details), 1.45 Å

PDB Description: X-ray structure of the cyan fluorescent protein mTurquoise-GL (K206A mutant) in space group C222(1)
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d4b5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b5ya1 d.22.1.1 (A:2-230) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlxvqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynyisgnvyitadkqkngikanfkirhniedggvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefltaagit

SCOPe Domain Coordinates for d4b5ya1:

Click to download the PDB-style file with coordinates for d4b5ya1.
(The format of our PDB-style files is described here.)

Timeline for d4b5ya1: