Lineage for d1a3qb1 (1a3q B:227-327)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038615Protein p52 subunit of NF-kappa B (NFKB) [49251] (1 species)
  7. 2038616Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry)
  8. 2038618Domain d1a3qb1: 1a3q B:227-327 [21933]
    Other proteins in same PDB: d1a3qa2, d1a3qb2
    protein/DNA complex

Details for d1a3qb1

PDB Entry: 1a3q (more details), 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna
PDB Compounds: (B:) protein (nuclear factor kappa-b p52)

SCOPe Domain Sequences for d1a3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3qb1 b.1.18.1 (B:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp

SCOPe Domain Coordinates for d1a3qb1:

Click to download the PDB-style file with coordinates for d1a3qb1.
(The format of our PDB-style files is described here.)

Timeline for d1a3qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3qb2