Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
Protein p52 subunit of NF-kappa B (NFKB) [49251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry) |
Domain d1a3qb1: 1a3q B:227-327 [21933] Other proteins in same PDB: d1a3qa2, d1a3qb2 protein/DNA complex |
PDB Entry: 1a3q (more details), 2.1 Å
SCOPe Domain Sequences for d1a3qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3qb1 b.1.18.1 (B:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]} nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp
Timeline for d1a3qb1: