SCOP 1.61: Domain d1a3qb1: 1a3q B:227-327

Lineage for d1a3qb1 (1a3q B:227-327)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein p52 subunit of NF-kappa B (NFKB), C-terminal domain [49251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry)

8. Domain d1a3qb1: 1a3q B:227-327 [21933]
   Other proteins in same PDB: d1a3qa2, d1a3qb2

Details for d1a3qb1

PDB Entry: 1a3q, 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna

SCOP Domain Sequences for d1a3qb1:

Sequence; same for both SEQRES and ATOM records:

>d1a3qb1 b.1.1.5 (B:227-327) p52 subunit of NF-kappa B (NFKB), C-terminal domain {Human (Homo sapiens)}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp

Timeline for d1a3qb1:

• d1a3qb1 first appeared (with stable ids) in SCOP 1.55
  
• d1a3qb1 appears in SCOP 1.59
  
• d1a3qb1 appears in SCOP 1.63
  
• d1a3qb1 appears in the current release, SCOPe 2.08