Lineage for d4b4wb1 (4b4w B:1-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890631Species Acinetobacter baumannii [TaxId:575584] [226445] (3 PDB entries)
  8. 2890637Domain d4b4wb1: 4b4w B:1-121 [219322]
    Other proteins in same PDB: d4b4wa2, d4b4wb2
    automated match to d1a4ia2
    complexed with 9l9, cl, gol, nap

Details for d4b4wb1

PDB Entry: 4b4w (more details), 2 Å

PDB Description: crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and an inhibitor
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d4b4wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4wb1 c.58.1.0 (B:1-121) automated matches {Acinetobacter baumannii [TaxId: 575584]}
malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv
gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd
g

SCOPe Domain Coordinates for d4b4wb1:

Click to download the PDB-style file with coordinates for d4b4wb1.
(The format of our PDB-style files is described here.)

Timeline for d4b4wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b4wb2