![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:575584] [226445] (3 PDB entries) |
![]() | Domain d4b4wb1: 4b4w B:1-121 [219322] Other proteins in same PDB: d4b4wa2, d4b4wb2 automated match to d1a4ia2 complexed with 9l9, cl, gol, nap |
PDB Entry: 4b4w (more details), 2 Å
SCOPe Domain Sequences for d4b4wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b4wb1 c.58.1.0 (B:1-121) automated matches {Acinetobacter baumannii [TaxId: 575584]} malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd g
Timeline for d4b4wb1: