SCOPe 2.06: Domain d1a3qa1: 1a3q A:227-327

Lineage for d1a3qa1 (1a3q A:227-327)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p52 subunit of NF-kappa B (NFKB) [49251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry)

8. Domain d1a3qa1: 1a3q A:227-327 [21932]
   Other proteins in same PDB: d1a3qa2, d1a3qb2
   protein/DNA complex

Details for d1a3qa1

PDB Entry: 1a3q, 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna

PDB Compounds: (A:) protein (nuclear factor kappa-b p52)

SCOPe Domain Sequences for d1a3qa1:

Sequence; same for both SEQRES and ATOM records:

>d1a3qa1 b.1.18.1 (A:227-327) p52 subunit of NF-kappa B (NFKB) {Human (Homo sapiens) [TaxId: 9606]}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp

Timeline for d1a3qa1:

• d1a3qa1 first appeared (with stable ids) in SCOP 1.55
  
• d1a3qa1 appears in SCOPe 2.05
  
• d1a3qa1 appears in SCOPe 2.07
  
• d1a3qa1 appears in the current release, SCOPe 2.08