Lineage for d1a3qa1 (1a3q A:227-327)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 105139Protein p52 subunit of NF-kappa B (NFKB), C-terminal domain [49251] (1 species)
  7. 105140Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry)
  8. 105141Domain d1a3qa1: 1a3q A:227-327 [21932]
    Other proteins in same PDB: d1a3qa2, d1a3qb2

Details for d1a3qa1

PDB Entry: 1a3q (more details), 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna

SCOP Domain Sequences for d1a3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3qa1 b.1.1.5 (A:227-327) p52 subunit of NF-kappa B (NFKB), C-terminal domain {Human (Homo sapiens)}
nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya
ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp

SCOP Domain Coordinates for d1a3qa1:

Click to download the PDB-style file with coordinates for d1a3qa1.
(The format of our PDB-style files is described here.)

Timeline for d1a3qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3qa2