![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.5: E set domains [49208] (23 proteins) |
![]() | Protein p52 subunit of NF-kappa B (NFKB), C-terminal domain [49251] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49252] (1 PDB entry) |
![]() | Domain d1a3qa1: 1a3q A:227-327 [21932] Other proteins in same PDB: d1a3qa2, d1a3qb2 |
PDB Entry: 1a3q (more details), 2.1 Å
SCOP Domain Sequences for d1a3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3qa1 b.1.1.5 (A:227-327) p52 subunit of NF-kappa B (NFKB), C-terminal domain {Human (Homo sapiens)} nlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqya ivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp
Timeline for d1a3qa1: