SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4b4vb1 (4b4v B:1-121)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127441Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2127442Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2127755Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2127756Protein automated matches [226864] (27 species)
    not a true protein
  7. 2127757Species Acinetobacter baumannii [TaxId:575584] [226445] (3 PDB entries)
  8. 2127761Domain d4b4vb1: 4b4v B:1-121 [219318]
    Other proteins in same PDB: d4b4va2, d4b4vb2
    automated match to d1a4ia2
    complexed with cl, gol, l34, nap

Details for d4b4vb1

PDB Entry: 4b4v (more details), 2 Å

PDB Description: Crystal structure of Acinetobacter baumannii N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor and inhibitor LY354899
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d4b4vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4vb1 c.58.1.0 (B:1-121) automated matches {Acinetobacter baumannii [TaxId: 575584]}
malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv
gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd
g

SCOPe Domain Coordinates for d4b4vb1:

Click to download the PDB-style file with coordinates for d4b4vb1.
(The format of our PDB-style files is described here.)

Timeline for d4b4vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b4vb2