Lineage for d4b4ub2 (4b4u B:122-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845850Species Acinetobacter baumannii [TaxId:575584] [226446] (3 PDB entries)
  8. 2845852Domain d4b4ub2: 4b4u B:122-282 [219315]
    Other proteins in same PDB: d4b4ua1, d4b4ub1, d4b4ub3
    automated match to d1a4ia1
    complexed with cl, edo, nap, peg

Details for d4b4ub2

PDB Entry: 4b4u (more details), 1.45 Å

PDB Description: Crystal structure of Acinetobacter baumannii N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor
PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d4b4ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4ub2 c.2.1.0 (B:122-282) automated matches {Acinetobacter baumannii [TaxId: 575584]}
vtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmammllqa
natvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdgggvgd
iqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg

SCOPe Domain Coordinates for d4b4ub2:

Click to download the PDB-style file with coordinates for d4b4ub2.
(The format of our PDB-style files is described here.)

Timeline for d4b4ub2: