| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:575584] [226446] (3 PDB entries) |
| Domain d4b4ub2: 4b4u B:122-282 [219315] Other proteins in same PDB: d4b4ua1, d4b4ub1, d4b4ub3 automated match to d1a4ia1 complexed with cl, edo, nap, peg |
PDB Entry: 4b4u (more details), 1.45 Å
SCOPe Domain Sequences for d4b4ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b4ub2 c.2.1.0 (B:122-282) automated matches {Acinetobacter baumannii [TaxId: 575584]}
vtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmammllqa
natvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdgggvgd
iqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg
Timeline for d4b4ub2: