SCOPe 2.08: Domain d4b4ub1: 4b4u B:1-121

Lineage for d4b4ub1 (4b4u B:1-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [226445] (3 PDB entries)

8. Domain d4b4ub1: 4b4u B:1-121 [219314]
   Other proteins in same PDB: d4b4ua2, d4b4ub2, d4b4ub3
   automated match to d1a4ia2
   complexed with cl, edo, nap, peg

Details for d4b4ub1

PDB Entry: 4b4u, 1.45 Å

PDB Description: Crystal structure of Acinetobacter baumannii N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor

PDB Compounds: (B:) Bifunctional protein folD

SCOPe Domain Sequences for d4b4ub1:

Sequence; same for both SEQRES and ATOM records:

>d4b4ub1 c.58.1.0 (B:1-121) automated matches {Acinetobacter baumannii [TaxId: 575584]}
malvldgralakqieenllvrvealkaktgrtpilatilvgddgasatyvrmkgnacrrv
gmdslkielpqettteqllaeieklnanpdvhgillqhpvpaqideracfdaislakdvd
g

Timeline for d4b4ub1:

• d4b4ub1 first appeared in SCOPe 2.03
  
• d4b4ub1 appears in SCOPe 2.07