SCOPe 2.08: Domain d4b4ua2: 4b4u A:122-282

Lineage for d4b4ua2 (4b4u A:122-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [226446] (3 PDB entries)

8. Domain d4b4ua2: 4b4u A:122-282 [219313]
   Other proteins in same PDB: d4b4ua1, d4b4ub1, d4b4ub3
   automated match to d1a4ia1
   complexed with cl, edo, nap, peg

Details for d4b4ua2

PDB Entry: 4b4u, 1.45 Å

PDB Description: Crystal structure of Acinetobacter baumannii N5, N10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD) complexed with NADP cofactor

PDB Compounds: (A:) Bifunctional protein folD

SCOPe Domain Sequences for d4b4ua2:

Sequence; same for both SEQRES and ATOM records:

>d4b4ua2 c.2.1.0 (A:122-282) automated matches {Acinetobacter baumannii [TaxId: 575584]}
vtclgfgrmamgeaaygsatpagimtilkennieiagkhavvvgrsailgkpmammllqa
natvtichsrtqnlpelvkqadiivgavgkaeliqkdwikqgavvvdagfhprdgggvgd
iqlqgieeiasaytpvpggvgpmtittlirqtveaaekalg

Timeline for d4b4ua2:

• d4b4ua2 first appeared in SCOPe 2.03
  
• d4b4ua2 appears in SCOPe 2.07