Lineage for d4b4mc_ (4b4m C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149676Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2149807Protein automated matches [191218] (4 species)
    not a true protein
  7. 2149836Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (10 PDB entries)
  8. 2149867Domain d4b4mc_: 4b4m C: [219310]
    Other proteins in same PDB: d4b4ma2
    automated match to d3zllb_
    complexed with cl, jwt, mes

Details for d4b4mc_

PDB Entry: 4b4m (more details), 2.35 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (C:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4b4mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4mc_ c.68.1.6 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d4b4mc_:

Click to download the PDB-style file with coordinates for d4b4mc_.
(The format of our PDB-style files is described here.)

Timeline for d4b4mc_: