SCOPe 2.06: Domain d1vkxb1: 1vkx B:547-650

Lineage for d1vkxb1 (1vkx B:547-650)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)

8. Domain d1vkxb1: 1vkx B:547-650 [21931]
   Other proteins in same PDB: d1vkxa1, d1vkxa2, d1vkxb2
   protein/DNA complex

Details for d1vkxb1

PDB Entry: 1vkx, 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

PDB Compounds: (B:) protein (nf-kappa b p50 subunit)

SCOPe Domain Sequences for d1vkxb1:

Sequence; same for both SEQRES and ATOM records:

>d1vkxb1 b.1.18.1 (B:547-650) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1vkxb1:

• d1vkxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1vkxb1 appears in SCOPe 2.05
  
• d1vkxb1 appears in SCOPe 2.07
  
• d1vkxb1 appears in the current release, SCOPe 2.08