SCOP 1.55: Domain d1vkxb1: 1vkx B:547-650

Lineage for d1vkxb1 (1vkx B:547-650)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (23 proteins)

6. Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)

8. Domain d1vkxb1: 1vkx B:547-650 [21931]
   Other proteins in same PDB: d1vkxa1, d1vkxa2, d1vkxb2

Details for d1vkxb1

PDB Entry: 1vkx, 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna

SCOP Domain Sequences for d1vkxb1:

Sequence; same for both SEQRES and ATOM records:

>d1vkxb1 b.1.1.5 (B:547-650) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
nlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1vkxb1:

• d1vkxb1 appears in SCOP 1.57
  
• d1vkxb1 appears in the current release, SCOPe 2.08