Lineage for d4b4ma1 (4b4m A:1-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898466Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2898597Protein automated matches [191218] (6 species)
    not a true protein
  7. 2898650Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (11 PDB entries)
  8. 2898679Domain d4b4ma1: 4b4m A:1-293 [219308]
    Other proteins in same PDB: d4b4ma2
    automated match to d3zllb_
    complexed with cl, jwt, mes

Details for d4b4ma1

PDB Entry: 4b4m (more details), 2.35 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (A:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4b4ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4ma1 c.68.1.6 (A:1-293) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d4b4ma1:

Click to download the PDB-style file with coordinates for d4b4ma1.
(The format of our PDB-style files is described here.)

Timeline for d4b4ma1: