| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
| Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
| Protein automated matches [190879] (8 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226812] (3 PDB entries) |
| Domain d4b4kh_: 4b4k H: [219302] automated match to d3rg8c_ |
PDB Entry: 4b4k (more details), 2.5 Å
SCOPe Domain Sequences for d4b4kh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b4kh_ c.23.8.0 (H:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvre
Timeline for d4b4kh_: