Lineage for d1nfkb1 (1nfk B:251-350)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 788965Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 788980Species Mouse (Mus musculus) [TaxId:10090] [49250] (10 PDB entries)
  8. 788986Domain d1nfkb1: 1nfk B:251-350 [21930]
    Other proteins in same PDB: d1nfka2, d1nfkb2
    protein/DNA complex

Details for d1nfkb1

PDB Entry: 1nfk (more details), 2.3 Å

PDB Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer
PDB Compounds: (B:) protein (nuclear factor kappa-b (nf-kb))

SCOP Domain Sequences for d1nfkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfkb1 b.1.18.1 (B:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOP Domain Coordinates for d1nfkb1:

Click to download the PDB-style file with coordinates for d1nfkb1.
(The format of our PDB-style files is described here.)

Timeline for d1nfkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfkb2