SCOP 1.57: Domain d1nfkb1: 1nfk B:251-350

Lineage for d1nfkb1 (1nfk B:251-350)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (24 proteins)

6. Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries)

8. Domain d1nfkb1: 1nfk B:251-350 [21930]
   Other proteins in same PDB: d1nfka2, d1nfkb2

Details for d1nfkb1

PDB Entry: 1nfk, 2.3 Å

PDB Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer

SCOP Domain Sequences for d1nfkb1:

Sequence; same for both SEQRES and ATOM records:

>d1nfkb1 b.1.1.5 (B:251-350) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1nfkb1:

• d1nfkb1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfkb1 appears in SCOP 1.59
  
• d1nfkb1 appears in the current release, SCOPe 2.08