Lineage for d4b4ke_ (4b4k E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839075Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 1839149Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 1839150Protein automated matches [190879] (7 species)
    not a true protein
  7. 1839151Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226812] (3 PDB entries)
  8. 1839164Domain d4b4ke_: 4b4k E: [219299]
    automated match to d3rg8c_

Details for d4b4ke_

PDB Entry: 4b4k (more details), 2.5 Å

PDB Description: Crystal structure of Bacillus anthracis PurE
PDB Compounds: (E:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d4b4ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4ke_ c.23.8.0 (E:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
kslvgvimgstsdwetmkyacdildelnipyekkvvsahrtpdymfeyaetarerglkvi
iagaggaahlpgmvaaktnlpvigvpvqskalngldsllsivqmpggvpvatvaigkags
tnagllaaqilgsfhddihdalelrreaiekdvregselv

SCOPe Domain Coordinates for d4b4ke_:

Click to download the PDB-style file with coordinates for d4b4ke_.
(The format of our PDB-style files is described here.)

Timeline for d4b4ke_: