Lineage for d4b4ga_ (4b4g A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868242Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 1868373Protein automated matches [191218] (2 species)
    not a true protein
  7. 1868374Species Pseudomonas aeruginosa [TaxId:208964] [193238] (10 PDB entries)
  8. 1868407Domain d4b4ga_: 4b4g A: [219289]
    automated match to d3zllb_
    complexed with cl, kkt, mes

Details for d4b4ga_

PDB Entry: 4b4g (more details), 2.5 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (A:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4b4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b4ga_ c.68.1.6 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d4b4ga_:

Click to download the PDB-style file with coordinates for d4b4ga_.
(The format of our PDB-style files is described here.)

Timeline for d4b4ga_: