Lineage for d4b4bb_ (4b4b B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133255Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 protein domains)
    automatically mapped to Pfam PF00483
  6. 2133386Protein automated matches [191218] (4 species)
    not a true protein
  7. 2133387Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (10 PDB entries)
  8. 2133409Domain d4b4bb_: 4b4b B: [219285]
    Other proteins in same PDB: d4b4ba2
    automated match to d3zllb_
    complexed with cl, gjb, mes

Details for d4b4bb_

PDB Entry: 4b4b (more details), 2.1 Å

PDB Description: Pseudomonas aeruginosa RmlA in complex with allosteric inhibitor
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d4b4bb_:

Sequence, based on SEQRES records: (download)

>d4b4bb_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

Sequence, based on observed residues (ATOM records): (download)

>d4b4bb_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiatl
enrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d4b4bb_:

Click to download the PDB-style file with coordinates for d4b4bb_.
(The format of our PDB-style files is described here.)

Timeline for d4b4bb_: