| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
| Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries) |
| Domain d1iknc_: 1ikn C: [21928] Other proteins in same PDB: d1ikna1, d1ikna2, d1iknd_ |
PDB Entry: 1ikn (more details), 2.3 Å
SCOPe Domain Sequences for d1iknc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iknc_ b.1.18.1 (C:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev
Timeline for d1iknc_: