Lineage for d1bfs__ (1bfs -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (24 proteins) 
Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [49250] (4 PDB entries) 
Domain d1bfs__: 1bfs - [21927]
Details for d1bfs__
PDB Entry: 1bfs (more details), 2.2 Å
PDB Description: structure of nf-kb p50 homodimer bound to a kb site
SCOP Domain Sequences for d1bfs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfs__ b.1.1.5 (-) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Mouse (Mus musculus)}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype
SCOP Domain Coordinates for d1bfs__:
Click to download the PDB-style file with coordinates for d1bfs__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bfs__:
- d1bfs__ first appeared (with stable ids) in SCOP 1.55
- d1bfs__ appears in SCOP 1.59
- d1bfs__ appears in the current release, SCOPe 2.08, called d1bfsa_
View in 3D