Lineage for d4b3ke_ (4b3k E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084215Species Streptococcus pyogenes [TaxId:1314] [226551] (2 PDB entries)
  8. 2084226Domain d4b3ke_: 4b3k E: [219265]
    automated match to d3vija_

Details for d4b3ke_

PDB Entry: 4b3k (more details), 2.6 Å

PDB Description: Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes
PDB Compounds: (E:) Beta-glucosidase

SCOPe Domain Sequences for d4b3ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b3ke_ c.1.8.0 (E:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
lafpkefwwggatsgpqsegrfakqhrnlfdywyeeepdlfydyvgpdtasdayhqiesd
ltllaslghnsyrtsiqwtrliddfeqatinpdglayynrvidaclangirpvinlhhfd
lpialyqayggweskhvvdlfvafskvcfeqfgdrvkdwfvhnepmvvvegsylmqfhyp
aivdgkkavqvaynlalatakviqayrrgpaelsdgrigtilnltpaypasqseadmaaa
hfaelwnndlfmeaavhgkfpeelvavlkkdgvlwqstpeelaliaenrvdylglnfyhp
krvkapdaipvispswspewyydpylmpgrrmnvdkgweiypeavydiaikmrdhydnip
wflsengvgisgedryrdetgqiqddyriqflkehltylhkgieagsncfgyhvwtpidg
wswlnayknryglvennihtqvrrpkasaywfkkvathnrl

SCOPe Domain Coordinates for d4b3ke_:

Click to download the PDB-style file with coordinates for d4b3ke_.
(The format of our PDB-style files is described here.)

Timeline for d4b3ke_: