Lineage for d4b3aa2 (4b3a A:68-208)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1279958Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1279959Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1279960Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1280226Protein automated matches [226970] (3 species)
    not a true protein
  7. 1280234Species Escherichia coli [TaxId:562] [226229] (3 PDB entries)
  8. 1280235Domain d4b3aa2: 4b3a A:68-208 [219260]
    Other proteins in same PDB: d4b3aa1
    automated match to d1qpia2
    complexed with cl, mg, tac; mutant

Details for d4b3aa2

PDB Entry: 4b3a (more details), 1.7 Å

PDB Description: tetracycline repressor class d mutant h100a in complex with tetracycline
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4b3aa2:

Sequence, based on SEQRES records: (download)

>d4b3aa2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d4b3aa2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltnlppllrealqimdsddgeqaflhgleslir
gfevqltallqiv

SCOPe Domain Coordinates for d4b3aa2:

Click to download the PDB-style file with coordinates for d4b3aa2.
(The format of our PDB-style files is described here.)

Timeline for d4b3aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b3aa1