Lineage for d1nfid_ (1nfi D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein p50 subunit of NF-kappa B transcription factor, C-terminal domain [49248] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [49249] (2 PDB entries) 
Domain d1nfid_: 1nfi D: [21926]
Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_
Details for d1nfid_
PDB Entry: 1nfi (more details), 2.7 Å
PDB Description: i-kappa-b-alpha/nf-kappa-b complex
SCOP Domain Sequences for d1nfid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfid_ b.1.1.5 (D:) p50 subunit of NF-kappa B transcription factor, C-terminal domain {Human (Homo sapiens)}
snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik
SCOP Domain Coordinates for d1nfid_:
Click to download the PDB-style file with coordinates for d1nfid_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nfid_:
- d1nfid_ appears in SCOP 1.57
- d1nfid_ appears in the current release, SCOPe 2.08
View in 3D
