| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
| Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
| Protein automated matches [191218] (6 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193238] (11 PDB entries) |
| Domain d4b2xc_: 4b2x C: [219257] Other proteins in same PDB: d4b2xa2, d4b2xb2 automated match to d3zllb_ complexed with cl, mes, niq |
PDB Entry: 4b2x (more details), 1.7 Å
SCOPe Domain Sequences for d4b2xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b2xc_ c.68.1.6 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mkrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdt
prfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhe
llgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydq
qvvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfia
tlenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy
Timeline for d4b2xc_: