Lineage for d4b1ra2 (4b1r A:68-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728220Protein automated matches [226970] (6 species)
    not a true protein
  7. 2728237Species Escherichia coli [TaxId:562] [226229] (9 PDB entries)
  8. 2728247Domain d4b1ra2: 4b1r A:68-208 [219252]
    Other proteins in same PDB: d4b1ra1, d4b1ra3
    automated match to d1qpia2
    complexed with cl, itc; mutant

Details for d4b1ra2

PDB Entry: 4b1r (more details), 1.95 Å

PDB Description: tetracycline repressor class d mutant h100a in complex with iso-7- chlortetracycline
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4b1ra2:

Sequence, based on SEQRES records: (download)

>d4b1ra2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Sequence, based on observed residues (ATOM records): (download)

>d4b1ra2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltlppllrealqimdsddgeqaflhgleslirg
fevqltallqiv

SCOPe Domain Coordinates for d4b1ra2:

Click to download the PDB-style file with coordinates for d4b1ra2.
(The format of our PDB-style files is described here.)

Timeline for d4b1ra2: