Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein automated matches [226970] (6 species) not a true protein |
Species Escherichia coli [TaxId:562] [226229] (9 PDB entries) |
Domain d4b1ra2: 4b1r A:68-208 [219252] Other proteins in same PDB: d4b1ra1, d4b1ra3 automated match to d1qpia2 complexed with cl, itc; mutant |
PDB Entry: 4b1r (more details), 1.95 Å
SCOPe Domain Sequences for d4b1ra2:
Sequence, based on SEQRES records: (download)
>d4b1ra2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]} lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl hgleslirgfevqltallqiv
>d4b1ra2 a.121.1.1 (A:68-208) automated matches {Escherichia coli [TaxId: 562]} lpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmtengfsl rdglyaisavshftlgavleqqehtaaltlppllrealqimdsddgeqaflhgleslirg fevqltallqiv
Timeline for d4b1ra2: