Lineage for d4b1ra1 (4b1r A:3-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306190Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2306195Domain d4b1ra1: 4b1r A:3-67 [219251]
    Other proteins in same PDB: d4b1ra2, d4b1ra3
    automated match to d1qpia1
    complexed with cl, itc; mutant

Details for d4b1ra1

PDB Entry: 4b1r (more details), 1.95 Å

PDB Description: tetracycline repressor class d mutant h100a in complex with iso-7- chlortetracycline
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d4b1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b1ra1 a.4.1.0 (A:3-67) automated matches {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d4b1ra1:

Click to download the PDB-style file with coordinates for d4b1ra1.
(The format of our PDB-style files is described here.)

Timeline for d4b1ra1: