Lineage for d1nfib_ (1nfi B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038586Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 2038587Species Human (Homo sapiens) [TaxId:9606] [49249] (3 PDB entries)
    Uniprot P25799 245-350
  8. 2038589Domain d1nfib_: 1nfi B: [21925]
    Other proteins in same PDB: d1nfia1, d1nfia2, d1nfic1, d1nfic2, d1nfie_, d1nfif_

Details for d1nfib_

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex
PDB Compounds: (B:) nf-kappa-b p50

SCOPe Domain Sequences for d1nfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfib_ b.1.18.1 (B:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik

SCOPe Domain Coordinates for d1nfib_:

Click to download the PDB-style file with coordinates for d1nfib_.
(The format of our PDB-style files is described here.)

Timeline for d1nfib_: